Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name |
Protein automated matches [190247] (4 species) not a true protein |
Species Halobacterium salinarum [TaxId:478009] [187023] (10 PDB entries) |
Domain d4b2ha_: 4b2h A: [197139] automated match to d2vkfa1 protein/DNA complex; complexed with c3f, cl, mg, na, so4 |
PDB Entry: 4b2h (more details), 1.6 Å
SCOPe Domain Sequences for d4b2ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2ha_ d.230.2.1 (A:) automated matches {Halobacterium salinarum [TaxId: 478009]} vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe ld
Timeline for d4b2ha_: