Lineage for d4auca_ (4auc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060652Species Cow (Bos taurus) [TaxId:9913] [50668] (6 PDB entries)
  8. 2060653Domain d4auca_: 4auc A: [197133]
    automated match to d3cmsa_
    complexed with cd, edo, na

Details for d4auca_

PDB Entry: 4auc (more details), 1.6 Å

PDB Description: Bovine chymosin in complex with Pepstatin A
PDB Compounds: (A:) chymosin

SCOPe Domain Sequences for d4auca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4auca_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]}
gevasvpltnyldsqyfgkiylgtppqeftvlfdtgssdfwvpsiycksnacknhqrfdp
rksstfqnlgkplsihygtgsmqgilgydtvtvsnivdiqqtvglstqepgdvftyaefd
gilgmaypslaseysipvfdnmmnrhlvaqdlfsvymdrngqesmltlgaidpsyytgsl
hwvpvtvqqywqftvdsvtisgvvvaceggcqaildtgtsklvgpssdilniqqaigatq
nqygefdidcdnlsymptvvfeingkmypltpsaytsqdqgfctsgfqsenhsqkwilgd
vfireyysvfdrannlvglakai

SCOPe Domain Coordinates for d4auca_:

Click to download the PDB-style file with coordinates for d4auca_.
(The format of our PDB-style files is described here.)

Timeline for d4auca_: