Lineage for d3s4ea_ (3s4e A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167923Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 1167924Protein automated matches [190475] (3 species)
    not a true protein
  7. 1167927Species Human (Homo sapiens) [TaxId:9606] [187400] (25 PDB entries)
  8. 1167928Domain d3s4ea_: 3s4e A: [197132]
    automated match to d1m3ga_
    complexed with po4, so4

Details for d3s4ea_

PDB Entry: 3s4e (more details), 1.26 Å

PDB Description: Crystal Structrue of a Novel Mitogen-activated Protein Kinase Phosphatase, SKRP1
PDB Compounds: (A:) Dual specificity protein phosphatase 19

SCOPe Domain Sequences for d3s4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s4ea_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asqvgvikpwlllgsqdaahdldtlkknkvthilnvaygvenaflsdftyksisildlpe
tnilsyfpecfefieeakrkdgvvlvhsnagvsraaaivigflmnseqtsftsafslvkn
arpsicpnsgfmeqlrtyqegkes

SCOPe Domain Coordinates for d3s4ea_:

Click to download the PDB-style file with coordinates for d3s4ea_.
(The format of our PDB-style files is described here.)

Timeline for d3s4ea_: