Lineage for d3s4ea1 (3s4e A:65-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875776Domain d3s4ea1: 3s4e A:65-206 [197132]
    Other proteins in same PDB: d3s4ea2
    automated match to d1m3ga_
    complexed with po4, so4

Details for d3s4ea1

PDB Entry: 3s4e (more details), 1.26 Å

PDB Description: Crystal Structrue of a Novel Mitogen-activated Protein Kinase Phosphatase, SKRP1
PDB Compounds: (A:) Dual specificity protein phosphatase 19

SCOPe Domain Sequences for d3s4ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s4ea1 c.45.1.0 (A:65-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvgvikpwlllgsqdaahdldtlkknkvthilnvaygvenaflsdftyksisildlpetn
ilsyfpecfefieeakrkdgvvlvhsnagvsraaaivigflmnseqtsftsafslvknar
psicpnsgfmeqlrtyqegkes

SCOPe Domain Coordinates for d3s4ea1:

Click to download the PDB-style file with coordinates for d3s4ea1.
(The format of our PDB-style files is described here.)

Timeline for d3s4ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s4ea2