Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (24 families) |
Family a.118.1.17: BC3264-like [109965] (3 proteins) Pfam PF06352; DUF1061 this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain |
Protein automated matches [197126] (1 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [197127] (1 PDB entry) |
Domain d3zbob_: 3zbo B: [197128] automated match to d1t06a_ complexed with cl |
PDB Entry: 3zbo (more details), 1.58 Å
SCOPe Domain Sequences for d3zbob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zbob_ a.118.1.17 (B:) automated matches {Bacillus cereus [TaxId: 1396]} mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc
Timeline for d3zbob_: