Lineage for d3zbob_ (3zbo B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1095603Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1095903Family a.118.1.17: BC3264-like [109965] (3 proteins)
    Pfam PF06352; DUF1061
    this is a repeat family; one repeat unit is 1t06 A:120-163 found in domain
  6. 1095912Protein automated matches [197126] (1 species)
    not a true protein
  7. 1095913Species Bacillus cereus [TaxId:1396] [197127] (1 PDB entry)
  8. 1095914Domain d3zbob_: 3zbo B: [197128]
    automated match to d1t06a_
    complexed with cl

Details for d3zbob_

PDB Entry: 3zbo (more details), 1.58 Å

PDB Description: a new family of proteins related to the heat-like repeat dna glycosylases with affinity for branched dna structures
PDB Compounds: (B:) alkf

SCOPe Domain Sequences for d3zbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zbob_ a.118.1.17 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc

SCOPe Domain Coordinates for d3zbob_:

Click to download the PDB-style file with coordinates for d3zbob_.
(The format of our PDB-style files is described here.)

Timeline for d3zbob_: