![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
![]() | Superfamily d.39.1: DLC [54648] (1 family) ![]() automatically mapped to Pfam PF01221 |
![]() | Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
![]() | Protein automated matches [190350] (4 species) not a true protein |
![]() | Species Toxoplasma gondii [TaxId:5811] [197122] (1 PDB entry) |
![]() | Domain d3rjsa_: 3rjs A: [197123] automated match to d1pwja_ |
PDB Entry: 3rjs (more details), 1.5 Å
SCOPe Domain Sequences for d3rjsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rjsa_ d.39.1.1 (A:) automated matches {Toxoplasma gondii [TaxId: 5811]} drkaviknadmpedlqqdaidcanqalekyniekdiaafikkefdrkhnptwhcvvgrnf gsyvthethhfiyfyigqvavllfksg
Timeline for d3rjsa_: