![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein N-terminal domain of sialoadhesin [48732] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries) Uniprot Q62230 20-130 |
![]() | Domain d1qfpa_: 1qfp A: [19711] |
PDB Entry: 1qfp (more details), 2.8 Å
SCOPe Domain Sequences for d1qfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfpa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
Timeline for d1qfpa_: