SCOPe 2.06: Domain d4j8aa1: 4j8a A:2-230

Lineage for d4j8aa1 (4j8a A:2-230)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d4j8aa1: 4j8a A:2-230 [197104]
   Other proteins in same PDB: d4j8aa2
   automated match to d2b3pa_
   complexed with edo, so4, trs

Details for d4j8aa1

PDB Entry: 4j8a, 1.26 Å

PDB Description: irradiated-state structure of sfgfp containing the unnatural amino acid p-azido-phenylalanine at residue 145

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4j8aa1:

Sequence; same for both SEQRES and ATOM records:

>d4j8aa1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
rielkgidfkedgnilghkleynxnshnvyitadkqkngikanfkirhnvedgsvqladh
yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagit

Timeline for d4j8aa1:

• d4j8aa1 first appeared in SCOPe 2.02, called d4j8aa_
  
• d4j8aa1 was called d4j8aa_ in SCOPe 2.05
  
• d4j8aa1 appears in SCOPe 2.07
  
• d4j8aa1 appears in the current release, SCOPe 2.08