SCOPe 2.06: Domain d4ixgx_: 4ixg X:

Lineage for d4ixgx_ (4ixg X:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)

8. Domain d4ixgx_: 4ixg X: [197103]
   automated match to d3nzbx_
   complexed with ixg, ndp

Details for d4ixgx_

PDB Entry: 4ixg, 1.7 Å

PDB Description: pcdhfr-268-k37s-n69f variant

PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4ixgx_:

Sequence; same for both SEQRES and ATOM records:

>d4ixgx_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfsrvtsfvptfdsfesmnvvlmgrk
twesiplqnrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

Timeline for d4ixgx_:

• d4ixgx_ first appeared in SCOPe 2.02
  
• d4ixgx_ appears in SCOPe 2.05
  
• d4ixgx_ appears in SCOPe 2.07
  
• d4ixgx_ appears in the current release, SCOPe 2.08