Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein N-terminal domain of sialoadhesin [48732] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48733] (2 PDB entries) |
Domain d1qfoc_: 1qfo C: [19710] complexed with gal, glc, sia |
PDB Entry: 1qfo (more details), 1.85 Å
SCOP Domain Sequences for d1qfoc_:
Sequence, based on SEQRES records: (download)
>d1qfoc_ b.1.1.1 (C:) N-terminal domain of sialoadhesin {Mouse (Mus musculus)} twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd
>d1qfoc_ b.1.1.1 (C:) N-terminal domain of sialoadhesin {Mouse (Mus musculus)} twgvsspknvqglsgscllipcifsypadvpgitaiwyydysgkrqvvihsgdpklvdkr frgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisnrwldvkgttvtvttd
Timeline for d1qfoc_: