Lineage for d4i5lc_ (4i5l C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440476Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1440477Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1440548Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1440554Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 1440555Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 1440556Domain d4i5lc_: 4i5l C: [197095]
    Other proteins in same PDB: d4i5la_, d4i5ld_
    automated match to d3fgac_
    complexed with ca, mli, mn, peg

Details for d4i5lc_

PDB Entry: 4i5l (more details), 2.43 Å

PDB Description: structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha

SCOPe Domain Sequences for d4i5lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5lc_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaprrg

SCOPe Domain Coordinates for d4i5lc_:

Click to download the PDB-style file with coordinates for d4i5lc_.
(The format of our PDB-style files is described here.)

Timeline for d4i5lc_: