![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.2: HEAT repeat [48385] (3 proteins) Pfam PF02985 this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain |
![]() | Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries) |
![]() | Domain d4i5la1: 4i5l A:9-589 [197094] Other proteins in same PDB: d4i5la2, d4i5lc_, d4i5ld2, d4i5lf_ automated match to d1b3ua_ complexed with ca, mli, mn, peg |
PDB Entry: 4i5l (more details), 2.43 Å
SCOPe Domain Sequences for d4i5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5la1 a.118.1.2 (A:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
Timeline for d4i5la1:
![]() Domains from other chains: (mouse over for more information) d4i5lc_, d4i5ld1, d4i5ld2, d4i5lf_ |