Lineage for d4gcja_ (4gcj A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434070Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1434071Species Human (Homo sapiens) [TaxId:9606] [88856] (335 PDB entries)
    Uniprot P24941
  8. 1434079Domain d4gcja_: 4gcj A: [197092]
    automated match to d3pxza_
    complexed with edo, x64

Details for d4gcja_

PDB Entry: 4gcj (more details), 1.42 Å

PDB Description: CDK2 in complex with inhibitor RC-3-89
PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4gcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gcja_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
lgspefmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisl
lkelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqg
lafchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeil
lgckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmp
dykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvp
hlrl

SCOPe Domain Coordinates for d4gcja_:

Click to download the PDB-style file with coordinates for d4gcja_.
(The format of our PDB-style files is described here.)

Timeline for d4gcja_: