Lineage for d1qfob_ (1qfo B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354801Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 2354802Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
    Uniprot Q62230 20-130
  8. 2354804Domain d1qfob_: 1qfo B: [19709]
    complexed with sia

Details for d1qfob_

PDB Entry: 1qfo (more details), 1.85 Å

PDB Description: n-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose
PDB Compounds: (B:) protein (sialoadhesin)

SCOPe Domain Sequences for d1qfob_:

Sequence, based on SEQRES records: (download)

>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt

Sequence, based on observed residues (ATOM records): (download)

>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsgitaiwyydysgkrqvvihsgdpklvd
krfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt

SCOPe Domain Coordinates for d1qfob_:

Click to download the PDB-style file with coordinates for d1qfob_.
(The format of our PDB-style files is described here.)

Timeline for d1qfob_: