| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein N-terminal domain of sialoadhesin [48732] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries) Uniprot Q62230 20-130 |
| Domain d1qfob_: 1qfo B: [19709] complexed with sia |
PDB Entry: 1qfo (more details), 1.85 Å
SCOPe Domain Sequences for d1qfob_:
Sequence, based on SEQRES records: (download)
>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt
>d1qfob_ b.1.1.1 (B:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsgitaiwyydysgkrqvvihsgdpklvd
krfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt
Timeline for d1qfob_: