SCOPe 2.08: Domain d4fofa1: 4fof A:431-591

Lineage for d4fofa1 (4fof A:431-591)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [197087] (8 PDB entries)

8. Domain d4fofa1: 4fof A:431-591 [197088]
   Other proteins in same PDB: d4fofa2
   automated match to d2k2na1
   complexed with pge, vrb

Details for d4fofa1

PDB Entry: 4fof, 2.42 Å

PDB Description: crystal structure of the blue-light absorbing form of the thermosynechococcus elongatus pixj gaf-domain

PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d4fofa1:

Sequence; same for both SEQRES and ATOM records:

>d4fofa1 d.110.2.0 (A:431-591) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
avqlselrdrqaifetlvakgrellacdrvivyafddnyvgtvvaesvaegwpqardqvi
edpcfrehwveayrqgriqattdifkagltechlnqlrplkvranlvvpmviddqlfgll
iahqaseprqwqeieidqfselastgslvlerlhfleqtia

Timeline for d4fofa1:

• d4fofa1 first appeared in SCOPe 2.02, called d4fofa_
  
• d4fofa1 appears in SCOPe 2.07