Lineage for d1qfoa_ (1qfo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757701Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 1757702Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
    Uniprot Q62230 20-130
  8. 1757703Domain d1qfoa_: 1qfo A: [19708]
    complexed with sia

Details for d1qfoa_

PDB Entry: 1qfo (more details), 1.85 Å

PDB Description: n-terminal domain of sialoadhesin (mouse) in complex with 3'sialyllactose
PDB Compounds: (A:) protein (sialoadhesin)

SCOPe Domain Sequences for d1qfoa_:

Sequence, based on SEQRES records: (download)

>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvtt

Sequence, based on observed residues (ATOM records): (download)

>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvgitaiwyydysgkrqvvihsgdpklvdk
rfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeissnrwldvkgttvtvtt

SCOPe Domain Coordinates for d1qfoa_:

Click to download the PDB-style file with coordinates for d1qfoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qfoa_: