![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (8 species) not a true protein |
![]() | Species Bos taurus [TaxId:9913] [197078] (1 PDB entry) |
![]() | Domain d4bbnf_: 4bbn F: [197079] Other proteins in same PDB: d4bbnc_ automated match to d3noba_ |
PDB Entry: 4bbn (more details), 2.51 Å
SCOPe Domain Sequences for d4bbnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bbnf_ d.15.1.1 (F:) automated matches {Bos taurus [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgc
Timeline for d4bbnf_: