SCOPe 2.08: Domain d4azja_: 4azj A:

Lineage for d4azja_ (4azj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)

7. Species Bacillus alcalophilus [TaxId:1445] [117697] (12 PDB entries)
   Uniprot Q9RME2

8. Domain d4azja_: 4azj A: [197074]
   automated match to d1w23a_
   complexed with cl, na, plp, sep

Details for d4azja_

PDB Entry: 4azj, 1.5 Å

PDB Description: structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase

PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d4azja_:

Sequence; same for both SEQRES and ATOM records:

>d4azja_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]}
vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

Timeline for d4azja_:

• d4azja_ first appeared in SCOPe 2.02
  
• d4azja_ appears in SCOPe 2.07