Lineage for d4aj7a_ (4aj7 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368271Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1368552Protein automated matches [190442] (11 species)
    not a true protein
  7. 1368592Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (4 PDB entries)
  8. 1368597Domain d4aj7a_: 4aj7 A: [197072]
    automated match to d1xwaa_
    complexed with act, gol, so4

Details for d4aj7a_

PDB Entry: 4aj7 (more details), 2.04 Å

PDB Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei (oxidized form).
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4aj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aj7a_ c.47.1.1 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

SCOPe Domain Coordinates for d4aj7a_:

Click to download the PDB-style file with coordinates for d4aj7a_.
(The format of our PDB-style files is described here.)

Timeline for d4aj7a_: