| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (15 species) not a true protein |
| Species Kineococcus radiotolerans [TaxId:131568] [197069] (1 PDB entry) |
| Domain d4a25a_: 4a25 A: [197070] automated match to d2z90b_ complexed with cl, mn |
PDB Entry: 4a25 (more details), 2 Å
SCOPe Domain Sequences for d4a25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a25a_ a.25.1.0 (A:) automated matches {Kineococcus radiotolerans [TaxId: 131568]}
ttihdvqttgltqdavtgfdassrlnaglqevlvdltalhlqgkqahwnivgenwrdlhl
qldtlveaargfsddvaermravggvpdarpqtvaasrigdvgpdeidtracveaivalv
rhtvdtirrvhdpidaedpasadllhaitlelekqawmigsenrspr
Timeline for d4a25a_: