SCOPe 2.06: Domain d1kacb_: 1kac B:

Lineage for d1kacb_ (1kac B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)

8. Domain d1kacb_: 1kac B: [19707]
   Other proteins in same PDB: d1kaca_

Details for d1kacb_

PDB Entry: 1kac, 2.6 Å

PDB Description: knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car

PDB Compounds: (B:) protein (coxsackie virus and adenovirus receptor)

SCOPe Domain Sequences for d1kacb_:

Sequence; same for both SEQRES and ATOM records:

>d1kacb_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga

Timeline for d1kacb_:

• d1kacb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kacb_ appears in SCOPe 2.05
  
• d1kacb_ appears in SCOPe 2.07
  
• d1kacb_ appears in the current release, SCOPe 2.08