![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries) |
![]() | Domain d1kacb_: 1kac B: [19707] Other proteins in same PDB: d1kaca_ |
PDB Entry: 1kac (more details), 2.6 Å
SCOPe Domain Sequences for d1kacb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kacb_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk psga
Timeline for d1kacb_: