Lineage for d1kacb_ (1kac B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739701Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 2739702Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 2739707Domain d1kacb_: 1kac B: [19707]
    Other proteins in same PDB: d1kaca_

Details for d1kacb_

PDB Entry: 1kac (more details), 2.6 Å

PDB Description: knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car
PDB Compounds: (B:) protein (coxsackie virus and adenovirus receptor)

SCOPe Domain Sequences for d1kacb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kacb_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga

SCOPe Domain Coordinates for d1kacb_:

Click to download the PDB-style file with coordinates for d1kacb_.
(The format of our PDB-style files is described here.)

Timeline for d1kacb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kaca_