SCOPe 2.02: Domain d3veqb_: 3veq B:

Lineage for d3veqb_ (3veq B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187001] (8 PDB entries)

8. Domain d3veqb_: 3veq B: [197066]
   Other proteins in same PDB: d3veqa_
   automated match to d1tgsz_
   complexed with ca; mutant

Details for d3veqb_

PDB Entry: 3veq, 2.25 Å

PDB Description: A binary complex betwwen bovine pancreatic trypsin and a engineered mutant trypsin inhibitor

PDB Compounds: (B:) cationic trypsin

SCOPe Domain Sequences for d3veqb_:

Sequence; same for both SEQRES and ATOM records:

>d3veqb_ b.47.1.2 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasvslptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcagklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3veqb_:

• d3veqb_ is new in SCOPe 2.02-stable
  
• d3veqb_ appears in SCOPe 2.03
  
• d3veqb_ appears in the current release, SCOPe 2.08