Lineage for d3zgva_ (3zgv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107583Protein automated matches [191258] (3 species)
    not a true protein
  7. 2107587Species Human (Homo sapiens) [TaxId:9606] [189817] (16 PDB entries)
  8. 2107595Domain d3zgva_: 3zgv A: [197061]
    automated match to d1j8fa_
    complexed with act, ar6, gol, pge, zn

Details for d3zgva_

PDB Entry: 3zgv (more details), 2.27 Å

PDB Description: Structure of human SIRT2 in complex with ADP-ribose
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d3zgva_:

Sequence, based on SEQRES records: (download)

>d3zgva_ c.31.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpype
aifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleria
gleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffg
eslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpf
lgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

Sequence, based on observed residues (ATOM records): (download)

>d3zgva_ c.31.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpype
aifeisyfkkhpepffalakelyqfkptichyfmrllkdkglllrcytqnidtleriagl
eqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffges
lparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpflg
mimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

SCOPe Domain Coordinates for d3zgva_:

Click to download the PDB-style file with coordinates for d3zgva_.
(The format of our PDB-style files is described here.)

Timeline for d3zgva_: