Lineage for d1f5wb_ (1f5w B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352643Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 2352644Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 2352648Domain d1f5wb_: 1f5w B: [19706]
    complexed with so4

Details for d1f5wb_

PDB Entry: 1f5w (more details), 1.7 Å

PDB Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain
PDB Compounds: (B:) coxsackie virus and adenovirus receptor

SCOPe Domain Sequences for d1f5wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5wb_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvl
v

SCOPe Domain Coordinates for d1f5wb_:

Click to download the PDB-style file with coordinates for d1f5wb_.
(The format of our PDB-style files is described here.)

Timeline for d1f5wb_: