SCOP 1.59: Domain d1f5wa_: 1f5w A:

Lineage for d1f5wa_ (1f5w A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (3 PDB entries)

8. Domain d1f5wa_: 1f5w A: [19705]

Details for d1f5wa_

PDB Entry: 1f5w, 1.7 Å

PDB Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain

SCOP Domain Sequences for d1f5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1f5wa_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)}
farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
vvlv

Timeline for d1f5wa_:

• d1f5wa_ first appeared (with stable ids) in SCOP 1.55
  
• d1f5wa_ appears in SCOP 1.57
  
• d1f5wa_ appears in SCOP 1.61
  
• d1f5wa_ appears in the current release, SCOPe 2.08