Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48731] (3 PDB entries) |
Domain d1f5wa_: 1f5w A: [19705] |
PDB Entry: 1f5w (more details), 1.7 Å
SCOP Domain Sequences for d1f5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5wa_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)} farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl vvlv
Timeline for d1f5wa_: