![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.4: STI-like [50386] (3 families) ![]() |
![]() | Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins) automatically mapped to Pfam PF00197 |
![]() | Protein chymotrypsin inhibitor WCI [50392] (1 species) |
![]() | Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [50393] (8 PDB entries) |
![]() | Domain d3veqa_: 3veq A: [197048] Other proteins in same PDB: d3veqb_ automated match to d2wbca_ complexed with ca; mutant |
PDB Entry: 3veq (more details), 2.25 Å
SCOPe Domain Sequences for d3veqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3veqa_ b.42.4.1 (A:) chymotrypsin inhibitor WCI {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]} dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri ssqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka
Timeline for d3veqa_: