SCOPe 2.07: Domain d3vsqa_: 3vsq A:

Lineage for d3vsqa_ (3vsq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)

8. Domain d3vsqa_: 3vsq A: [197047]
   automated match to d2e4fa_
   complexed with bme, mg; mutant

Details for d3vsqa_

PDB Entry: 3vsq, 2 Å

PDB Description: crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol

PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 2

SCOPe Domain Sequences for d3vsqa_:

Sequence, based on SEQRES records:

>d3vsqa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshivrasir
aklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlp
keeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhety
etstpslsakelaelanra

Sequence, based on observed residues (ATOM records):

>d3vsqa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qryvrkdgkcnvhhgnvkraetlvfsthavismrdgklclmfrvgdlrnshivrasirak
likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
stpslsakelaelanra

Timeline for d3vsqa_:

• d3vsqa_ first appeared in SCOPe 2.02
  
• d3vsqa_ appears in SCOPe 2.06
  
• d3vsqa_ appears in the current release, SCOPe 2.08