Lineage for d3vsqa_ (3vsq A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1112278Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 1112292Protein automated matches [190782] (1 species)
    not a true protein
  7. 1112293Species Mouse (Mus musculus) [TaxId:10090] [188028] (7 PDB entries)
  8. 1112295Domain d3vsqa_: 3vsq A: [197047]
    automated match to d2e4fa_
    complexed with bme, mg; mutant

Details for d3vsqa_

PDB Entry: 3vsq (more details), 2 Å

PDB Description: crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2 e236r mutant in the presence of ethanol
PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 2

SCOPe Domain Sequences for d3vsqa_:

Sequence, based on SEQRES records: (download)

>d3vsqa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshivrasir
aklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlp
keeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhety
etstpslsakelaelanra

Sequence, based on observed residues (ATOM records): (download)

>d3vsqa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qryvrkdgkcnvhhgnvkraetlvfsthavismrdgklclmfrvgdlrnshivrasirak
likskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpke
eleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhetyet
stpslsakelaelanra

SCOPe Domain Coordinates for d3vsqa_:

Click to download the PDB-style file with coordinates for d3vsqa_.
(The format of our PDB-style files is described here.)

Timeline for d3vsqa_: