Lineage for d3s2ua_ (3s2u A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142579Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [197045] (1 PDB entry)
  8. 2142580Domain d3s2ua_: 3s2u A: [197046]
    automated match to d1f0ka_
    complexed with ud1

Details for d3s2ua_

PDB Entry: 3s2u (more details), 2.23 Å

PDB Description: Crystal structure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex
PDB Compounds: (A:) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

SCOPe Domain Sequences for d3s2ua_:

Sequence, based on SEQRES records: (download)

>d3s2ua_ c.87.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gnvlimaggtgghvfpalacarefqargyavhwlgtprgiendlvpkaglplhliqvsgl
rgkglkslvkaplellkslfqalrvirqlrpvcvlglggyvtgpgglaarlngvplvihe
qnavagtanrslapiarrvceafpdtfpasdkrlttgnpvrgelfldaharapltgrrvn
llvlggslgaeplnkllpealaqvpleirpairhqagrqhaeitaeryrtvaveadvapf
isdmaaayawadlvicragaltvseltaaglpaflvplphaiddhqtrnaeflvrsgagr
llpqkstgaaelaaqlsevlmhpetlrsmadqarslakpeatrtvvdacleva

Sequence, based on observed residues (ATOM records): (download)

>d3s2ua_ c.87.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gnvlimaggtgghvfpalacarefqargyavhwlgtprgiendlvpkaglplhliqaple
llkslfqalrvirqlrpvcvlglggyvtgpgglaarlngvplviheqnavagtanrslap
iarrvceafpdtfparlttgnpvrgelfldaharapltgrrvnllvlggslgaeplnkll
pealaqvpleirpairhqagrqhaeitaeryrtvaveadvapfisdmaaayawadlvicr
agaltvseltaaglpaflvpddhqtrnaeflvrsgagrllpqkstgaaelaaqlsevlmh
petlrsmadqarslakpeatrtvvdacleva

SCOPe Domain Coordinates for d3s2ua_:

Click to download the PDB-style file with coordinates for d3s2ua_.
(The format of our PDB-style files is described here.)

Timeline for d3s2ua_: