SCOPe 2.04: Domain d4j2ka_: 4j2k A:

Lineage for d4j2ka_ (4j2k A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (5 species)
   not a true protein

7. Species Enterolobium contortisiliquum [TaxId:55671] [197031] (2 PDB entries)

8. Domain d4j2ka_: 4j2k A: [197032]
   automated match to d1tiea_
   complexed with gol, imd

Details for d4j2ka_

PDB Entry: 4j2k, 1.75 Å

PDB Description: crystal structure of a plant trypsin inhibitor ecti

PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d4j2ka_:

Sequence, based on SEQRES records:

>d4j2ka_ b.42.4.0 (A:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycegnsdddsckdlgisiddennrllvvkdgdplavrfvkahr

Sequence, based on observed residues (ATOM records):

>d4j2ka_ b.42.4.0 (A:) automated matches {Enterolobium contortisiliquum [TaxId: 55671]}
kelldsdgdilrnggtyyilpalrgkggglelaktgdetcplnvvqarsetkrgrpaiiw
tppriailtpafylniefqtrdlpacleeysrlpwkvegesqevkiapkeeeqhlfgsfk
ikpyrddyklvycesckdlgisiddennrllvvkdgdplavrfvkahr

Timeline for d4j2ka_:

• d4j2ka_ first appeared in SCOPe 2.02
  
• d4j2ka_ appears in SCOPe 2.03
  
• d4j2ka_ appears in SCOPe 2.05
  
• d4j2ka_ appears in the current release, SCOPe 2.08