SCOPe 2.06: Domain d1d4ea1: 1d4e A:4-102

Lineage for d1d4ea1 (1d4e A:4-102)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)

7. Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries)

8. Domain d1d4ea1: 1d4e A:4-102 [19703]
   Other proteins in same PDB: d1d4ea2, d1d4ea3
   complexed with fad, fum, hem

Details for d1d4ea1

PDB Entry: 1d4e, 2.8 Å

PDB Description: crystal structure of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1 complexed with fumarate

PDB Compounds: (A:) flavocytochrome c fumarate reductase

SCOPe Domain Sequences for d1d4ea1:

Sequence, based on SEQRES records:

>d1d4ea1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphksh
ligeiactschkgheksvaycdachsfgfdmpfggkwer

Sequence, based on observed residues (ATOM records):

>d1d4ea1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapvsphkshlig
eiactschkgheksvaycdachsfgfdmpfggkwer

Timeline for d1d4ea1:

• d1d4ea1 first appeared (with stable ids) in SCOP 1.55
  
• d1d4ea1 appears in SCOPe 2.05
  
• d1d4ea1 appears in SCOPe 2.07
  
• d1d4ea1 appears in the current release, SCOPe 2.08