Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein automated matches [190999] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188735] (17 PDB entries) |
Domain d4hjja1: 4hjj A:37-192 [197022] Other proteins in same PDB: d4hjja2, d4hjjl1, d4hjjl2, d4hjjl3 automated match to d2vxti_ complexed with cl, gol, so4 |
PDB Entry: 4hjj (more details), 2.1 Å
SCOPe Domain Sequences for d4hjja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hjja1 b.42.1.2 (A:37-192) automated matches {Human (Homo sapiens) [TaxId: 9606]} yfgklesklsvirnlndqvlfidqgnrplfedmtdsdardnaprtifiismykdsqprgm avtisvkaekistlsaenkiisfkemnppdnikdtksdiiffqrsvpghdnkmqfesssy egyflaaekerdlfklilkkedelgdrsimftvqne
Timeline for d4hjja1: