Lineage for d1d4da1 (1d4d A:4-102)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649671Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 649672Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 649759Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 649790Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (3 species)
  7. 649824Species Shewanella putrefaciens [TaxId:24] [48723] (3 PDB entries)
  8. 649825Domain d1d4da1: 1d4d A:4-102 [19702]
    Other proteins in same PDB: d1d4da2, d1d4da3

Details for d1d4da1

PDB Entry: 1d4d (more details), 2.5 Å

PDB Description: crystal structure of the succinate complexed form of the flavocytochrome c fumarate reductase of shewanella putrefaciens strain mr-1
PDB Compounds: (A:) flavocytochrome c fumarate reductase

SCOP Domain Sequences for d1d4da1:

Sequence, based on SEQRES records: (download)

>d1d4da1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapkdkvsphksh
ligeiactschkgheksvaycdachsfgfdmpfggkwer

Sequence, based on observed residues (ATOM records): (download)

>d1d4da1 a.138.1.3 (A:4-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella putrefaciens [TaxId: 24]}
vladfhgemggcdschvsdkggvtndnlthengqcvschgdlkelaaaapvsphkshlig
eiactschkgheksvaycdachsfgfdmpfggkwer

SCOP Domain Coordinates for d1d4da1:

Click to download the PDB-style file with coordinates for d1d4da1.
(The format of our PDB-style files is described here.)

Timeline for d1d4da1: