Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52611] (87 PDB entries) |
Domain d4hb3a_: 4hb3 A: [197019] Other proteins in same PDB: d4hb3b_ automated match to d1qg4b_ complexed with cl, gnp, mg |
PDB Entry: 4hb3 (more details), 2.8 Å
SCOPe Domain Sequences for d4hb3a_:
Sequence, based on SEQRES records: (download)
>d4hb3a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv mdpalaaqyehdlevaqttalpdedddl
>d4hb3a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappeva aqyehdlevaqttalpdedddl
Timeline for d4hb3a_: