Lineage for d4gvma_ (4gvm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124027Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2124028Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [267758] (4 PDB entries)
  8. 2124030Domain d4gvma_: 4gvm A: [197016]
    automated match to d1bl3c_
    complexed with ars, lf2; mutant

Details for d4gvma_

PDB Entry: 4gvm (more details), 2.16 Å

PDB Description: hiv-1 integrase catalytic core domain a128t mutant complexed with allosteric inhibitor
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4gvma_:

Sequence, based on SEQRES records: (download)

>d4gvma_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvktacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkt
avqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4gvma_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvktacwwagikqefgipynpesmnkelkkiigqvrdqaehlktavqmav
fihnkkrkggggysagerivdiiatdiq

SCOPe Domain Coordinates for d4gvma_:

Click to download the PDB-style file with coordinates for d4gvma_.
(The format of our PDB-style files is described here.)

Timeline for d4gvma_: