Lineage for d4grya_ (4gry A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116409Protein Tyrosine phosphatase [52806] (7 species)
  7. 2116543Species Human (Homo sapiens), shp-1 [TaxId:9606] [52811] (4 PDB entries)
  8. 2116545Domain d4grya_: 4gry A: [197014]
    automated match to d1fpra_
    complexed with so4

Details for d4grya_

PDB Entry: 4gry (more details), 1.7 Å

PDB Description: crystal structure of shp1 catalytic domain with so4
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d4grya_:

Sequence, based on SEQRES records: (download)

>d4grya_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]}
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
psepggvlsfldqinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdi
diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklev

Sequence, based on observed residues (ATOM records): (download)

>d4grya_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]}
gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
nanyiknqllnaktyiasqgcleatvndfwqmawqensrvivmttrevpywpevgmqray
gpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgvpsepggvlsfld
qinqrqeslphagpiivhssagigrtgtiividmlmenistkgldcdidiqktiqmvraq
rsgmvqteaqykfiyvaiaqfiettkkklev

SCOPe Domain Coordinates for d4grya_:

Click to download the PDB-style file with coordinates for d4grya_.
(The format of our PDB-style files is described here.)

Timeline for d4grya_: