Lineage for d4f2ia1 (4f2i A:2-79)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876492Species Mycobacterium tuberculosis [TaxId:83332] [197006] (1 PDB entry)
  8. 2876493Domain d4f2ia1: 4f2i A:2-79 [197007]
    Other proteins in same PDB: d4f2ia2
    automated match to d1r7ha_
    complexed with no3

Details for d4f2ia1

PDB Entry: 4f2i (more details), 1.67 Å

PDB Description: Crystal structure of glutaredoxin-like NrdH from Mycobacterium tuberculosis
PDB Compounds: (A:) Glutaredoxin NrdH, putative

SCOPe Domain Sequences for d4f2ia1:

Sequence, based on SEQRES records: (download)

>d4f2ia1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaalta

Sequence, based on observed residues (ATOM records): (download)

>d4f2ia1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvagndhws
gfrpdrikalagaalta

SCOPe Domain Coordinates for d4f2ia1:

Click to download the PDB-style file with coordinates for d4f2ia1.
(The format of our PDB-style files is described here.)

Timeline for d4f2ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f2ia2