SCOPe 2.08: Domain d4f2ia1: 4f2i A:2-79

Lineage for d4f2ia1 (4f2i A:2-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [197006] (1 PDB entry)

8. Domain d4f2ia1: 4f2i A:2-79 [197007]
   Other proteins in same PDB: d4f2ia2
   automated match to d1r7ha_
   complexed with no3

Details for d4f2ia1

PDB Entry: 4f2i, 1.67 Å

PDB Description: Crystal structure of glutaredoxin-like NrdH from Mycobacterium tuberculosis

PDB Compounds: (A:) Glutaredoxin NrdH, putative

SCOPe Domain Sequences for d4f2ia1:

Sequence, based on SEQRES records:

>d4f2ia1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaalta

Sequence, based on observed residues (ATOM records):

>d4f2ia1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvagndhws
gfrpdrikalagaalta

Timeline for d4f2ia1:

• d4f2ia1 first appeared in SCOPe 2.02, called d4f2ia_
  
• d4f2ia1 appears in SCOPe 2.07