SCOPe 2.02: Domain d4eo7a_: 4eo7 A:

Lineage for d4eo7a_ (4eo7 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.0: automated matches [196997] (1 protein)
   not a true family

6. Protein automated matches [196998] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [196999] (2 PDB entries)

8. Domain d4eo7a_: 4eo7 A: [197002]
   automated match to d1fywa_
   complexed with mg

Details for d4eo7a_

PDB Entry: 4eo7, 1.45 Å

PDB Description: Crystal structure of the TIR domain of human myeloid differentiation primary response protein 88.

PDB Compounds: (A:) Myeloid differentiation primary response protein MyD88

SCOPe Domain Sequences for d4eo7a_:

Sequence; same for both SEQRES and ATOM records:

>d4eo7a_ c.23.2.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
ggvdmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaseli
ekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfit
vcdytnpctkswfwtrlakalslp

Timeline for d4eo7a_:

• d4eo7a_ is new in SCOPe 2.02-stable
  
• d4eo7a_ appears in SCOPe 2.03
  
• d4eo7a_ appears in the current release, SCOPe 2.08, called d4eo7a1