Lineage for d4eo7a_ (4eo7 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158445Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 1158459Family c.23.2.0: automated matches [196997] (1 protein)
    not a true family
  6. 1158460Protein automated matches [196998] (1 species)
    not a true protein
  7. 1158461Species Homo sapiens [TaxId:9606] [196999] (2 PDB entries)
  8. 1158462Domain d4eo7a_: 4eo7 A: [197002]
    automated match to d1fywa_
    complexed with mg

Details for d4eo7a_

PDB Entry: 4eo7 (more details), 1.45 Å

PDB Description: Crystal structure of the TIR domain of human myeloid differentiation primary response protein 88.
PDB Compounds: (A:) Myeloid differentiation primary response protein MyD88

SCOPe Domain Sequences for d4eo7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eo7a_ c.23.2.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
ggvdmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvwsiaseli
ekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefpsilrfit
vcdytnpctkswfwtrlakalslp

SCOPe Domain Coordinates for d4eo7a_:

Click to download the PDB-style file with coordinates for d4eo7a_.
(The format of our PDB-style files is described here.)

Timeline for d4eo7a_: