Lineage for d4e3ya_ (4e3y A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174327Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2174328Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2174394Family d.4.1.2: DNA/RNA non-specific endonuclease [54066] (2 proteins)
    the core motif is inserted in a six-stranded meander beta-sheet domain
    automatically mapped to Pfam PF01223
  6. 2174399Protein Sm endonuclease [54067] (1 species)
  7. 2174400Species Serratia marcescens [TaxId:615] [54068] (5 PDB entries)
  8. 2174401Domain d4e3ya_: 4e3y A: [197001]
    automated match to d1g8ta_
    complexed with edo, gol, mg, peg, so4

Details for d4e3ya_

PDB Entry: 4e3y (more details), 0.95 Å

PDB Description: X-ray structure of the Serratia marcescens endonuclease at 0.95 A resolution
PDB Compounds: (A:) Nuclease

SCOPe Domain Sequences for d4e3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3ya_ d.4.1.2 (A:) Sm endonuclease {Serratia marcescens [TaxId: 615]}
sidncavgcptggssnvsivrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpa
lnpadtlapadytganaalkvdrghqaplaslagvsdweslnylsnitpqksdlnqgawa
rledqerklidradissvytvtgplyerdmgklpgtqkahtipsaywkvifinnspavnh
yaaflfdqntpkgadfcqfrvtvdeiekrtgliiwaglpddvqaslkskpgvlpelmgck

SCOPe Domain Coordinates for d4e3ya_:

Click to download the PDB-style file with coordinates for d4e3ya_.
(The format of our PDB-style files is described here.)

Timeline for d4e3ya_: