Lineage for d4arua_ (4aru A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128215Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2128216Protein automated matches [196989] (10 species)
    not a true protein
  7. 2128217Species Hafnia alvei [TaxId:569] [196990] (3 PDB entries)
  8. 2128218Domain d4arua_: 4aru A: [196996]
    automated match to d1dkla_
    complexed with cl, k, na, tla

Details for d4arua_

PDB Entry: 4aru (more details), 1.45 Å

PDB Description: Hafnia Alvei phytase in complex with tartrate
PDB Compounds: (A:) Histidine acid phosphatase

SCOPe Domain Sequences for d4arua_:

Sequence, based on SEQRES records: (download)

>d4arua_ c.60.1.0 (A:) automated matches {Hafnia alvei [TaxId: 569]}
apagfqlervvilsrhgvraptkmtqtmrdvtphqwpewpvklgyitprgehlislmggf
yrerfqqqgllpkdncptpdavyvwadvdqrtrktgeaflaglapqcdlaihhqqntqqa
dplfhpvkagicsmdksqvhaavekqagtpietlnqryqaslalmssvldfpkspycqqh
nigklcdfsqampsrlainddgnkvalegavglastlaeifllehaqgmpkvawgnihte
qqwnsllklhnaqfdlmsrtpyiakhngtpllqtiahalgsnitsrplpdispdnkilfi
aghdtnianisgmlgmtwtlpgqpdntppggalvferwvdnagkpyvsvnmvyqtlaqlh
dqapltlqhpagsvrlnipgcsdqtpdgycplstfsrlvshsvepacqlp

Sequence, based on observed residues (ATOM records): (download)

>d4arua_ c.60.1.0 (A:) automated matches {Hafnia alvei [TaxId: 569]}
apagfqlervvilsrhgvraptkmtqtmrdvtphqwpewpvklgyitprgehlislmggf
yrerfqqqgllpkdncptpdavyvwadvdqrtrktgeaflaglapqcdlaihhqqntqqa
dplfhpvkagicsmdksqvhaavekqagtpietlnqryqaslalmssvldfpkspycqqh
cdfsqampsrlainddgnkvalegavglastlaeifllehaqgmpkvawgnihteqqwns
llklhnaqfdlmsrtpyiakhngtpllqtiahalgsnitsrplpdispdnkilfiaghdt
nianisgmlgmtwtlpgqpdntppggalvferwvdnagkpyvsvnmvyqtlaqlhdqapl
tlqhpagsvrlnipgcsdqtpdgycplstfsrlvshsvepacqlp

SCOPe Domain Coordinates for d4arua_:

Click to download the PDB-style file with coordinates for d4arua_.
(The format of our PDB-style files is described here.)

Timeline for d4arua_: