Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins) bacterial metal-binding, lipocalin-like protein |
Protein automated matches [196992] (1 species) not a true protein |
Species Salmonella enterica [TaxId:440534] [196993] (2 PDB entries) |
Domain d4arha_: 4arh A: [196994] automated match to d1oeja_ complexed with so4 |
PDB Entry: 4arh (more details), 2.3 Å
SCOPe Domain Sequences for d4arha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4arha_ b.60.1.4 (A:) automated matches {Salmonella enterica [TaxId: 440534]} apmteveqkaaagvfddanvrdraltdwdgmwqsvypylvsgeldpvfrqkakkdpektf edikayyrkgyvtnvetigiengviefhrdnnvasckynyagykiltyasgkkgvrylfe ckdanskapkyvqfsdhiiaprksahfhifmgntsqqallqemenwptyypyqlkanevv demlhh
Timeline for d4arha_: