Lineage for d4arha_ (4arh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805489Family b.60.1.4: Hypothetical protein YodA [101863] (2 proteins)
    bacterial metal-binding, lipocalin-like protein
    automatically mapped to Pfam PF09223
  6. 2805504Protein automated matches [196992] (1 species)
    not a true protein
  7. 2805505Species Salmonella enterica [TaxId:440534] [196993] (3 PDB entries)
  8. 2805507Domain d4arha_: 4arh A: [196994]
    automated match to d1oeja_
    complexed with so4

Details for d4arha_

PDB Entry: 4arh (more details), 2.3 Å

PDB Description: X ray structure of the periplasmic zinc binding protein ZinT from Salmonella enterica
PDB Compounds: (A:) Metal-binding protein yodA

SCOPe Domain Sequences for d4arha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4arha_ b.60.1.4 (A:) automated matches {Salmonella enterica [TaxId: 440534]}
apmteveqkaaagvfddanvrdraltdwdgmwqsvypylvsgeldpvfrqkakkdpektf
edikayyrkgyvtnvetigiengviefhrdnnvasckynyagykiltyasgkkgvrylfe
ckdanskapkyvqfsdhiiaprksahfhifmgntsqqallqemenwptyypyqlkanevv
demlhh

SCOPe Domain Coordinates for d4arha_:

Click to download the PDB-style file with coordinates for d4arha_.
(The format of our PDB-style files is described here.)

Timeline for d4arha_: