Lineage for d4aroa_ (4aro A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128215Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2128216Protein automated matches [196989] (10 species)
    not a true protein
  7. 2128217Species Hafnia alvei [TaxId:569] [196990] (3 PDB entries)
  8. 2128219Domain d4aroa_: 4aro A: [196991]
    automated match to d1dkma_
    complexed with ihs, k, peg

Details for d4aroa_

PDB Entry: 4aro (more details), 1.59 Å

PDB Description: hafnia alvei phytase in complex with myo-inositol hexakis sulphate
PDB Compounds: (A:) Histidine acid phosphatase

SCOPe Domain Sequences for d4aroa_:

Sequence, based on SEQRES records: (download)

>d4aroa_ c.60.1.0 (A:) automated matches {Hafnia alvei [TaxId: 569]}
apagfqlekvvilsrhgvraptkmtqtmrdvtphqwpewpvklgyitprgehlislmggf
yrerfqqqgllpkdncptpdavyvwadvdqrtrktgeaflaglapqcdlaihhqqntqqa
dplfhpvkagicsmdksqvhaavekqagtpietlnqryqaslalmssvldfpkspycqqh
nigklcdfsqampsrlainddgnkvalegavglastlaeifllehaqgmpkvawgnihte
qqwnsllklhnaqfdlmsrtpyiakhngtpllqtiahalgsnitsrplpdispdnkilfi
aghdanianisgmlgmtwtlpgqpdntppggalvferwvdnagkpyvsvnmvyqtlaqlh
dqapltlqhpagsvrlnipgcsdqtpdgycplstfsrlvshsvepacqlp

Sequence, based on observed residues (ATOM records): (download)

>d4aroa_ c.60.1.0 (A:) automated matches {Hafnia alvei [TaxId: 569]}
apagfqlekvvilsrhgvraptkmtqtmrdvtphqwpewpvklgyitprgehlislmggf
yrerfqqqgllpkcptpdavyvwadvdqrtrktgeaflaglapqcdlaihhqqntqqadp
lfhpvkagicsmdksqvhaavekqagtpietlnqryqaslalmssvldfpkspycqqhlc
dfsqampsrlaignkvalegavglastlaeifllehaqgmpkvawgnihteqqwnsllkl
hnaqfdlmsrtpyiakhngtpllqtiahalgsnitsrplpdispdnkilfiaghdanian
isgmlgmtwtlpgqpdntppggalvferwvdnagkpyvsvnmvyqtlaqlhdqapltlqh
pagsvrlnipgcsdqtpdgycplstfsrlvshsvepacqlp

SCOPe Domain Coordinates for d4aroa_:

Click to download the PDB-style file with coordinates for d4aroa_.
(The format of our PDB-style files is described here.)

Timeline for d4aroa_: