Lineage for d3zkwb_ (3zkw B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2161232Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 2161233Protein Enterochelin uptake protein CeuE [142792] (1 species)
  7. 2161234Species Campylobacter jejuni [TaxId:197] [142793] (9 PDB entries)
    Uniprot Q0P8Q4 44-330
  8. 2161237Domain d3zkwb_: 3zkw B: [196986]
    automated match to d2chua1

Details for d3zkwb_

PDB Entry: 3zkw (more details), 1.71 Å

PDB Description: Periplasmic Binding Protein CeuE apo form
PDB Compounds: (B:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d3zkwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkwb_ c.92.2.4 (B:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]}
ipismsdegdsflvkdsigenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

SCOPe Domain Coordinates for d3zkwb_:

Click to download the PDB-style file with coordinates for d3zkwb_.
(The format of our PDB-style files is described here.)

Timeline for d3zkwb_: