Lineage for d3u9pc_ (3u9p C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804824Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)
  8. 2804832Domain d3u9pc_: 3u9p C: [196983]
    Other proteins in same PDB: d3u9ph_, d3u9pk_, d3u9pl1, d3u9pl2, d3u9pm1, d3u9pm2
    automated match to d3s26a_

Details for d3u9pc_

PDB Entry: 3u9p (more details), 2.8 Å

PDB Description: crystal structure of murine siderocalin in complex with an fab fragment
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3u9pc_:

Sequence, based on SEQRES records: (download)

>d3u9pc_ b.60.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lipapslltvplqpdfrsdqfrgrwyvvglagnavqkktegsftmystiyelqennsynv
tsilvrdqdqgcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvffr
ktsenkqyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidn

Sequence, based on observed residues (ATOM records): (download)

>d3u9pc_ b.60.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lipapslltvplqpdfrsdqfrgrwyvvglagnavqkktegsftmystiyelqennsynv
tsilvrcrywirtfvpssragqftlgnmhrypqvqsynvqvattdynqfamvffrktsen
kqyfkitlygrtkelspelkerftrfakslglkddniifsvptdqcidn

SCOPe Domain Coordinates for d3u9pc_:

Click to download the PDB-style file with coordinates for d3u9pc_.
(The format of our PDB-style files is described here.)

Timeline for d3u9pc_: