Lineage for d4k8la_ (4k8l A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199029Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1199030Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1199093Family d.21.1.3: Proline racemase [110863] (2 proteins)
    Pfam PF05544
  6. 1199098Protein automated matches [196979] (1 species)
    not a true protein
  7. 1199099Species Ochrobactrum anthropi [TaxId:439375] [196980] (1 PDB entry)
  8. 1199100Domain d4k8la_: 4k8l A: [196981]
    automated match to d1tm0a_

Details for d4k8la_

PDB Entry: 4k8l (more details), 1.9 Å

PDB Description: crystal structure of a putative 4-hydroxyproline epimerase/3- hydroxyproline dehydratse from the soil bacterium ochrobacterium anthropi, target efi-506495, disordered loops
PDB Compounds: (A:) proline racemase

SCOPe Domain Sequences for d4k8la_:

Sequence, based on SEQRES records: (download)

>d4k8la_ d.21.1.3 (A:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
smrstkvihivgchaegevgdvivggvapppgktvweqsrfiasdetlrnfvlneprggv
frhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiipmqepvtrmvle
apgglieveaecrngkaerisvrnvpsfadrlnasleveglgtitvdtayggdsfvivda
asigmkiepgqarelaeigvkitkaaneqlgfrhpekdwnhisfcqitepvtrdgdiltg
vntvairpakldrsptgtgcsarmavlhakgqmkvgerfigksvlgtefhcrldktlelg
gkpaispiisgrawvtgtsqlmldpsdpfpsgy

Sequence, based on observed residues (ATOM records): (download)

>d4k8la_ d.21.1.3 (A:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
smrstkvihivgchaegevgdvivggvapppgktvweqsrfiasdetlrnfvlneprggv
frhvnllvppkdpraqmgfiimepadtppmsgsnsicvstvlldsgiipmqepvtrmvle
apgglieveaecrngkaerisvrnvpsfadrlnaslevgtitvdtayggdsfvivdaasi
gmelaeigvkitkaaneqlgfrhpekdwnhisfcqitepvtrdgdiltgvntvaitgtgc
sarmavlhakgqmkvgerfighcrldktlelggkpaispiisgrawvtgtsqlmldpsdp
fpsgy

SCOPe Domain Coordinates for d4k8la_:

Click to download the PDB-style file with coordinates for d4k8la_.
(The format of our PDB-style files is described here.)

Timeline for d4k8la_: