Lineage for d4j2ha_ (4j2h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848474Species Sinorhizobium meliloti [TaxId:266834] [189876] (13 PDB entries)
  8. 2848484Domain d4j2ha_: 4j2h A: [196973]
    automated match to d2uvdd_
    complexed with 1pe, edo, na

Details for d4j2ha_

PDB Entry: 4j2h (more details), 2.1 Å

PDB Description: Crystal structure of a putative short-chain alcohol dehydrogenase from Sinorhizobium meliloti 1021 (Target NYSGRC-011708)
PDB Compounds: (A:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d4j2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j2ha_ c.2.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
pifdlsgrralvtgasrgigqsiavalaeagahvavtartveglaetraliektgrrava
laqdvrdveacasvtraaaeglggldilvnnagfenvrpsfdvdealwdtivstnlkgaf
fcaqaagrimadanggaivnlcsltsyvgiptavpygasksgllgvtralatewaahnir
vnaiapgyfrtamtagfyededwqsrmlekipqrrfgkesdiggvavflcsdaaayitgh
cipadggylasi

SCOPe Domain Coordinates for d4j2ha_:

Click to download the PDB-style file with coordinates for d4j2ha_.
(The format of our PDB-style files is described here.)

Timeline for d4j2ha_: